Bienvenue sur le réseau d'annuaires classés! Utilisateur en ligneS'inscrire maintenant

Home | Monitor

  • 2022-01-10Date de collecte
  • 2022-02-15Mise à jour
Home | Monitor
  • Adresse du site Web:www.monitor.co.ug
  • IP du serveur:104.18.7.65
  • Description du site:Surveillance quotidienne, vérité quotidienne.

nom de domaine:www.monitor.co.ugÉvaluation

sur 500~20000

nom de domaine:www.monitor.co.ugcouler

483

nom de domaine:www.monitor.co.ugBon ou Mauvais

Tout va bien. Riche et Noble Ji

site Internet:Home | MonitorPoids

1

site Internet:Home | MonitorIP

104.18.7.65

site Internet:Home | Monitorteneur

window.dataLayer=window.dataLayer||[];dataLayer.push({'contentId':'','contentType':'CMChannel','nigationPath':'','userSegments':'/uganda'});(function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':newDate().getTime(),event:'gtm.js'});varf=d.getElementsByTName(s)[0],j=d.createElement(s),dl=l!='dataLayer'?'&l='+l:'';j.async=true;j.src='/gtm.js?id='+i+dl;f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-TTSDR7W');Home|Monitor{"@type":"Organization","name":"Monitor","url":"","logo":{"@type":"ImeObject","url":"/resource/crblob//61e515b0ca6d190ede/dm-structured-data-logo-png-data.png","width":242,"height":60},"sameAs":["/c/dailymonitor","twitter.com/DailyMonitor","/DailyMonitor","/dailymonitorug/"],"@context":"schema.org"}{"@type":"WebPe","@id":"/uganda","name":"Uganda","description":"DailyMonitor,thetrutheveryday.","@context":"httpschema.org"}{"@context":"schema.org","@type":"BreadcrumbList","itemListElement":[{"@type":"ListItem","position":1,"name":"Home","item":"/uganda"}]}@font-face{font-family:"Roboto";font-style:normal;font-weight:400;font-display:fallback;src:local('Roboto'),local('Roboto-Regular'),url(/resource/crblob//314b3e27a8fc4d780a703b8c6d60eb2e/roboto-regular-woff2-data.woff2)format('woff2'),url(/resource/crblob//396f61f2524c1a087da7fe4cf/roboto-regular-woff-data.woff)format('woff'),url(/resource/crblob//84a6341fddcb66cd50fbdd9a79/roboto-regular-ttf-data.ttf)format('ttf');unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"Roboto";font-style:normal;font-weight:500;font-display:fallback;src:local('RobotoMedium'),local('Roboto-Medium'),url(/resource/crblob//dcc5e5d97ba8acca0d909ab2e27/roboto-medium-woff2-data.woff2)format('woff2'),url(/resource/crblob//1e49e636e023a5500a51d168/roboto-medium-woff-data.woff)format('woff'),url(/resource/crblob//b5f1fa86b2300b6e6258ec7ff/roboto-medium-ttf-data.ttf)format('ttf');unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"Roboto";font-style:normal;font-weight:700;font-display:fallback;src:local('RobotoBold'),local('Roboto-Bold'),url(/resource/crblob//e5fb1b696f3b64ab1e978eb8a92/roboto-bold-woff2-data.woff2)format('woff2'),url(/resource/crblob//3eba6b17da134b2434afb8ad6d2c83a4/roboto-bold-woff-data.woff)format('woff');unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"Roboto";font-style:italic;font-weight:400;font-display:fallback;src:local('RobotoItalic'),local('Roboto-Italic'),url(/resource/crblob//c20ba07e455c114afdbe6c7eb51/roboto-italic-woff2-data.woff2)format('woff2'),url(/resource/crblob//5bb930cee50ab6c47fdc6f/roboto-italic-woff-data.woff)format('woff');unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"Roboto";font-style:italic;font-weight:700;font-display:fallback;src:local('RobotoBoldItalic'),local('Roboto-BoldItalic'),url(/resource/crblob//f13d361ffda533c07c9a3df7c140c61c/roboto-bolditalic-woff2-data.woff2)format('woff2'),url(/resource/crblob//f7308fd720d9f134b6c3b749b90d2edf/roboto-bolditalic-woff-data.woff)format('woff');unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"Morion";font-style:normal;font-weight:300;font-display:fallback;src:url(/resource/crblob//d98fb2e51bb541e2e1094c8e/morion-light-woff2-data.woff2)format("woff2"),url(/resource/crblob//9e36b3c52b6e9ce720c804ff/morion-light-woff-data.woff)format("woff");}@font-face{font-family:"Morion";font-style:normal;font-weight:400;font-display:fallback;src:url(/resource/crblob//8ffbf8eeeae9c/morion-regular-woff2-data.woff2)format("woff2"),url(/resource/crblob//d3d0f9d8049e5cd34bcfd551/morion-regular-woff-data.woff)format("woff"),url(/resource/crblob//f527ba7953bce/morion-regular-ttf-data.ttf)format("truetype");}@font-face{font-family:"Morion";font-weight:600;font-display:fallback;src:url(/resource/crblob//db592c09b66baab62cac/morion-semibold-woff2-data.woff2)format("woff2"),url(/resource/crblob//4b3380c8a84bfbcfb90/morion-semibold-woff-data.woff)format("woff"),url(/resource/crblob//19f56ebe6468b58e44a/morion-semibold-ttf-data.ttf)format("truetype");}@font-face{font-family:"Morion";font-weight:600;font-style:italic;font-display:fallback;src:url(/resource/crblob//950d6833fefafa7f7783d2176a/morion-semibolditalic-woff2-data.woff2)format("woff2"),url(/resource/crblob//3394fd8e0b9bcf395bddc1586d/morion-semibolditalic-woff-data.woff)format("woff"),url(/resource/crblob//8fc6226dcb8da45cb68afc4bcd1/morion-semibolditalic-ttf-data.ttf)format("truetype");}.color-set-color-1{background:#B9002D;color:#FFFFFF;}.color-set-color-2{background:#E;color:#FFFFFF;}.color-set-color-3{background:#FF415D;color:#;}.color-set-color-4{background:#FF415D;color:#;}.color-set-color-5{background:#F5F5F5;color:#;}.color-set-color-6{background:#FFC3CA;color:#;}.color-set-color-7{background:#F0F0F0;color:#;}.color-set-color-8{background:#F8F8F8;color:#;}.color-set-color-9{background:#FFC3CA;color:#;}.color-set-color-10{background:#FFC3CA;color:#;}window.dataLayer=window.dataLayer||[];functiongt(){dataLayer.push(arguments);}gt('js',newDate());gt('config','G-98B005M16M');window.gt=gt;varicons=newXML();icons.open("GET","/resource/crblob//259aff1de3b77d5989bab9dd/icons-svg-data.svg");icons.send();icons.onload=function(){vard=document.createElement("div");d.innerHTML=icons.responseText;d.style="display:none";document.body.insertBefore(d,document.body.childNodes[0]);}functiongoogleSignIn(credentialResponse){window.handleGoogleSignIn(credentialResponse);}window.googlet=window.googlet||{cmd:[]};window.windowInnerWidth=window.innerWidth;window.adDesktopBreakPoint=1000;window.adSlots={};functionshouldRenderAd(isMobileAd){return(window.windowInnerWidthwindow.adDesktopBreakPoint&&!isMobileAd);}googlet.cmd.push(function(){window.bk_dfp_integration=window.bk_dfp_integration||{};window.bk_dfp_integration.functions=window.bk_dfp_integration.functions||{};if(typeofbk_dfp_integration.functions.sendDfp==="function"){bk_dfp_integration.functions.sendDfp();}googlet.pubads().setTargeting('url',window.location.pathname.split('/')[1]);if(window.location.pathname.split('/')[2]){googlet.pubads().setTargeting('url1',window.location.pathname.split('/')[2]);}if(window.location.pathname.split('/')[3]){googlet.pubads().setTargeting('url2',window.location.pathname.split('/')[3]);}if(windowInnerWidthwindow.adDesktopBreakPoint){window.adSlots['desktop-home-row-ad-5']=googlet.defineSlot("//DM-hm-728x90-sports",[[728,90],[970,90]],"desktop-home-row-ad-5").addService(googlet.pubads());}if(windowInnerWidth>window.adDesktopBreakPoint){window.adSlots['desktop-home-row-ad-6']=googlet.defineSlot("//DM-hm-728x90-stream",[[728,90],[970,90]],"desktop-home-row-ad-6").addService(googlet.pubads());}if(windowInnerWidth>window.adDesktopBreakPoint){window.adSlots['desktop-home-row-ad-7']=googlet.defineSlot("//DM-hm-728x90-footer",[[728,90],[970,90]],"desktop-home-row-ad-7").addService(googlet.pubads());}googlet.defineOutOfPeSlot('//DMoutofpe','div-gpt-ad-94-0').addService(googlet.pubads());googlet.pubads().enableSingleRequest();googlet.pubads().collapseEmptyDivs();googlet.enableServices();});googlet.cmd.push(function(){googlet.display('div-gpt-ad-94-0');});if(shouldRenderAd(false)){googlet.cmd.push(function(){googlet.display("desktop-home-above-nigation");});}CloseMenuePaperUgandaEditionAfricaEditionKenyaEditionTanzaniaEditionSearchLoginSignupMyAccountPersonaldetailsChangepasswordPurchasesSignoutUgandaUganda|MonitorNewsBusinessOpEdSpecialReportsMazinesSportsLifestyleJobsAudioPuzzlesMoreSearchNewsNationalEducationInsightWorldBusinessProsperCommoditiesFinanceMarketsTechnologyInsuranceAutoOpEdEditorialColumnistsCommentaryLettersCartoonSpecialReportsMonitor@30ElectionsUganda@50GenderProjectSuccessAminMazinesFullWomanPeople&PowerHealthyLivingJobsandCareerScoreLifeHomesandPropertyFarmingSportsSoccerWorldCupBasketballBoxingCricketAthleticsRugbyGolfMotorSportOtherSportSportsColumnistsLifestyleDiningEntertainmentTrelReviewsHome | Monitor&ProfilesReligionHearttoHeartFashion&BeautyJobsTendersSupplementsAudioNewsPodcastsSportsPodcastsBusinessPodcastsLifestylePodcastsPuzzlesEditionsAfricaKenyaUgandaTheCitizenePaperDailyMonitorDailyNationEmpowerUganda.Saturday,June15,2024ChaosatcourtasgunmentakeMPAkambaMrAkamba’sco-accused,MsNamujjuandMrMutembuliweredeniedbailduetomissingdocumentationessentialinthegrantofbailNational11hoursoPRIMEFULLLIST:MPswhosignedcensuremotionNational19hoursoUniversitystudentstippedonmaningmentalhealthNational13hoursoif(shouldRenderAd(true)){googlet.cmd.push(function(){googlet.display("mobile-home-row-ad-1");});}Stopdwellinginthepast,focusondevt-KatikkirotellsLuweroresidentsTherewasalsoastrongcallforestablishingfacilitiesthatwouldaddvaluetoLuwero’sriculturalproducts,particularlypineapples,whichareabundantintheareaNational10hoursoRareearthboomleesBugwerifarmers,leaderswaryFarming17hoursoCourtdismissesrapecaseainstpastorNational14hoursoOfficialsorderwetlandrestorationafterherbicideuseonWorldBankprojectNational15hoursoMPsNamujju,Mutembulideniedbail,furtherremandedMsAcirospecificallycitedSection77oftheMistratesCourtAct,whichrequiresanLCletterasproofofresidenceforbailapplicationsNational15hoursoMusevenistopsauctionofPearlofAfricaHotelNationalYesterdayPolicemanshootsmistrateinKenyancourtNews22hoursoAchelambowamongexpectedchangesforCranesOneofthemostanticipatedchangesistheinclusionofwicketkeeper-batsmanFredAchelam.CricketYesterdayif(shouldRenderAd(true)){googlet.cmd.push(function(){googlet.display("mobile-home-sidebar");});}NEMAaskspolicetorelocatepostfromswampasencroachersareevictedif(shouldRenderAd(false)){googlet.cmd.push(function(){googlet.display("desktop-home-sidebar");});}EducationPRIMEMubsresearchtochangelivesEducationJun10PRIMEElizabethOnenbelievesinmotivationofpupils,parentsplayingtheirroleEducationJun10PRIMEUncoveringgapsinearlychildeducationEducationJun07if(shouldRenderAd(false)){googlet.cmd.push(function(){googlet.display("desktop-home-sidebar-1");});}BrandBookMTNUgandaexceedscommitmentstosupportSt.Joseph’sAidSocietyin39;30DaysofY’elloCare39;CampaignBrandBook16hoursoBunyangabuandKibaleSharetheSpoilsinThrillingOpenerinTooroKingdomMTNAmasazaCup2024BrandBookJun10TheRiseofGhostjobs&jobscamsinUgandaBrandBookJun10if(shouldRenderAd(false)){googlet.cmd.push(function(){googlet.display("desktop-home-sidebar-2");});}VideosCorruptionmustbedealtwithquickly,decisively-MuseveniVideo20hoursoUgandamustlivewithinhermeans-expertsVideo20hoursoMoreMPsmayfacearrestinbudgetcorruptionprobeVideo20hoursoNEMAaskspolicetorelocatepostfromswampasencroachersareevictedVideo20hoursoif(shouldRenderAd(true)){googlet.cmd.push(function(){googlet.display("mobile-home-row-ad-2");});}if(shouldRenderAd(false)){googlet.cmd.push(function(){googlet.display("desktop-home-row-ad-1");});}NewsNationalEducationInsightWorldDeputyIGGtipsdistrictofficialsonoptimisingpublicfundsSorotiCityPlanner,MrAndrewIteba,acknowledgedchallengesfacedbythecity,includingdelayedcentralgovernmentfundreleasesNational12hoursoCourtfixeshearingdateforlandfraudcaseainstbusinessman National18hoursoPRIMEShs500million39;serviceaward39;splitsUIA,FinanceNational20hoursoEntebbeauthorities,contractorclashoverdelayedcompletionofmultibilliontaxiparkNational18hoursoRegionalgovernmentsfocusondebtrepaymentNational20hoursoNgambaChimpanzeeIslandclosesforresidentialvisitorsNational19hoursoAlbinostogetfreesunscreenlotions,saysKadaNational19hoursoTeenecouplelivesinfearofarrestNational19hoursoPRIMEHownewtaxeswillaffectregionaltradeNational21hoursoMasakaCityresidentsupinarmsovergarbefeesNational19hoursoBudget:Focusonallocations,notamount–expertsFinance21hoursoHowKampalansreceivedbudgetFinance20hoursoFarmers,districtplannersdecry‘disastrous’riculturebudgetcutNational20hoursoAllNewsif(shouldRenderAd(true)){googlet.cmd.push(function(){googlet.display("mobile-home-row-ad-3");});}if(shouldRenderAd(false)){googlet.cmd.push(function(){googlet.display("desktop-home-row-ad-2");});}OpEdEditorialColumnistsCommentaryLettersCartoonPRIMECrimefight:Let’sstartwithminorproblemsInUgandatoday,especiallyinKampalaCity,theBrokenWindowsTheoryisundoubtedlyatplay:Itpartlyexplainswhyable-bodiedpeople,enoughinnumbers,onaKampalastreetcanjustlookon...Commentary22hoursoPRIMETherationalityofbodabodadecisionsCommentaryYesterdayThinkaboutfreenurseryeducationforallEditorial22hoursoPRIMEBookazinesmaygiveprintmediaalifelineBichachi23hoursoPRIMEInternalauditors:evolutionofacrucialprofessionCommentary23hoursoWhatifMuseveniusesanti-corruptioncard?Letters22hoursoPRIMETodayshouldbecalledPutYourHandsUpAndHandMatiaAllYourMoneyDayKalinakiYesterdayPRIMEMwenda’sactionsstemfromaprofounddedicationtofosteringpeaceinDRCCommentaryYesterdayNRMdoesn’twalkthetalkoncorruptionCommentaryYesterdayMindsetchangeshouldstartwithleadersEditorialYesterdayAllOpEdif(shouldRenderAd(true)){googlet.cmd.push(function(){googlet.display("mobile-home-row-ad-4");});}if(shouldRenderAd(false)){googlet.cmd.push(function(){googlet.display("desktop-home-row-ad-3");});}MazinesFullWomanPeople&PowerHealthyLivingJobsandCareerScoreLifeHomesandPropertyFarmingRareearthboomleesBugwerifarmers,leaderswaryA27-yearminingprojectvaluedatShs60.1trillionisgainingboom,makingfarmersandleaderswaryFarming17hoursoPRIMEIntegrityisanon-negotiableJobsandCareer23hoursoPRIMESickleethatendedinterminationJobsandCareer23hoursoWhydesignatingsafeschoolzonesiskeyAutoYesterdayPRIMEMuyombya’sLandRoverDefenderisfast,fuel-efficient AutoYesterdayAllMazinesif(shouldRenderAd(true)){googlet.cmd.push(function(){googlet.display("mobile-home-row-ad-5");});}if(shouldRenderAd(false)){googlet.cmd.push(function(){googlet.display("desktop-home-row-ad-4");});}BusinessProsperCommoditiesFinanceMarketsTechnologyInsuranceAutoThoseofuswhogotoborrowaretreatedlikechildren,saysKasaija MrKasaijasaystherewasneedtomobilisemorerevenuesdomesticallybyclosingtaxleakestostoprelianceonborrowingandgrantsFinance18hoursoPRIMEWillUgandaconsolidaterecentlyachievedmiddle-incomegains? Finance22hoursoEastAfrica39;sfailuretoharmonisetaxesimpactingtrade,saysEABC Markets22hoursoMTN39;sunsoldsharesaleofferoversubscribed MarketsYesterdayPRIMEOppositioninsistsonShs44trillionalternativebudgetFinanceYesterdayGovtcarriesdebtburden intonewfinancialyear FinanceJun12PRIME‘Boosthealthsectorfundingto20%ofNationalBudget’ProsperJun11PRIMEWillbudgetanswerUganda’sVision2040? ProsperJun11PRIMEImportingormanufacturing:WhereisthesmartiHome | Monitornvestment?ProsperJun11Shs1trillionriculturalsectorloansremainunutilisedFinanceJun10AllBusinessif(shouldRenderAd(true)){googlet.cmd.push(function(){googlet.display("mobile-home-row-ad-6");});}if(shouldRenderAd(false)){googlet.cmd.push(function(){googlet.display("desktop-home-row-ad-5");});}GalleriesNewsBusinessOpEdSpecialReportsMazinesSportsLifestyleJobsAudioPuzzlesEntebbehostsdronboatraceatlaunchofUganda-ChinatourismseasonPictorialJun09PRIMEPICTURES:Museveni39;sstateofthenationaddressPictorialJun06PRIMEMartyrs39;DaythroughthelensPictorialJun04PRIMEBobicountrywidemobilisationtourstartssmooth,continuesamidteargas,policethreatsaheadof2026PictorialMay22AllGalleriesif(shouldRenderAd(true)){googlet.cmd.push(function(){googlet.display("mobile-home-row-ad-7");});}if(shouldRenderAd(false)){googlet.cmd.push(function(){googlet.display("desktop-home-row-ad-6");});}LifestyleDiningEntertainmentTrelReviews&ProfilesReligionHearttoHeartFashion&BeautyBreakingintothecityspaceAgoodexampleinthisanalysiswouldbewesternUgandansinger,RayG,whohashadhissuccessesovertimeandrecentlyshutdownLugogoCricketOvalwithaconcertthatsawrevellersfromall...Entertainment23hoursoPRIMEKampalanightlifeisdead,andpastorsaresilentEntertainment23hoursoPRIME50yearslater,theSsenkebejjestietheknotHearttoHeartYesterdayIhefailedtomoveonfrommyex-loverHearttoHeartYesterdayPRIMEWhatischapati?Breakfast?Lunch?Snack?PickastruggleReviews&ProfilesJun12AllLifestyleif(shouldRenderAd(true)){googlet.cmd.push(function(){googlet.display("mobile-home-row-ad-8");});}if(shouldRenderAd(false)){googlet.cmd.push(function(){googlet.display("desktop-home-row-ad-7");});}SpecialReportsMonitor@30ElectionsUganda@50GenderProjectSuccessAminPRIMEWhyforeignworkersarebeingframedinKarumapowerprojectDespitesignificantprogressingrowingthenumberofpeoplewithaccesstoelectricity,itisstillhardfordevelopingcountriestomeetthe7thSustainableDevelopmentGoal(SDG)ofallhing...SpecialReportsJun11TheforgottenvictimsofLakeKyoga’srecurrentfloodsinGalilaayaSpecialReportsJun11PWDsremainpoordespitegovernment’sspecialgrantSpecialReportsJun11VIDEO:$400mclimatecashmiredindonorpoliticsSpecialReportsJun10PRIMEWhyKarimojongwomen,childrenfacetoughchoicesSpecialReportsJun04PRIMENUPcrossesswordswithgovtainSpecialReportsJun05PRIMEHowTumusiimerestored800hectaresofNyakambuWetlandSpecialReportsJun04PRIMECharcoalburning devastateslandscapesinnorthernUgandaSpecialReportsMay27PRIMENewdetailsemergeonKibweteredeathSpecialReportsMay25PRIMEHanyiga:ThebrainbehindBamasaabaculturalanthem SpecialReportsMay24PRIMEActnowtoreduceclimatepollutantsandcutemissions–expertSpecialReportsMay19PRIMESumayiyaMbabazionsucceedinginamasculinejobSpecialReportsMay17PRIMEWheniscriticismofIsraelanti-semitic?SpecialReportsMay17AllSpecialReportsMONITORSPORTSSoccerWorldCupBasketballBoxingCricketAthleticsRugbyGolfMotorSportOtherSportSportsColumnistsMutyabagoalnotenoughasUgandaCranesloseathomeAlgeriatopthegroup.SoccerJun11PRIMEAlgeriaextinguishfire,26yearsonSoccerJun11PRIMEChancetokilloffwoundedDesertFoxesSoccerJun10FormpushesMugishatoTurkishAirlinesGolfWorldCupGolfJun09SuperchampionsParkcapoffadominantseasonOtherSportJun09AllMONITORSPORTSAUDIONewsPodcastsSportsPodcastsBusinessPodcastsLifestylePodcastsPRIMEStrategiestoenhancevalueofUganda39;sexportsAudioApr05PRIMEUproaroverParliamentbudgetAudioApr02PRIMEMuntutalksFDCfallout,lifeafter2021pollsAudioApr02PRIMEManingUganda39;sdebtburdenAudioMar27AllAUDIONewsNationalEducationInsightWorldBusinessProsperCommoditiesFinanceMarketsTechnologyInsuranceAutoOpEdEditorialColumnistsCommentaryLettersCartoonSpecialReportsMonitor@30ElectionsUganda@50GenderProjectSuccessAminMazinesFullWomanPeople&PowerHealthyLivingJobsandCareerScoreLifeHomesandPropertyFarmingSportsSoccerWorldCupBasketballBoxingCricketAthleticsRugbyGolfMotorSportOtherSportSportsColumnistsLifestyleDiningEntertainmentTrelReviews&ProfilesReligionHearttoHeartFashion&BeautyJobsTendersSupplementsAudioNewsPodcastsSportsPodcastsBusinessPodcastsLifestylePodcastsPuzzlesOurBlogRulesContactUsAdvertisewithusFrequentlyaskedquestionsNMGPrivacyPolicyTermsandConditionsofUseTermsofuseWebmailNationMediaGroup©2024RegistertocontinuereadingthispremiumarticleIt39;sfree!Yes,please!Youalreadyheanaccount?LoginRegistertobeginyourjourneytoourpremiumcontentSubscribeforfullaccesstopremiumcontentAccessthebestofMonitor39;sIndependentJournalismSubscribeYoualreadyheaSubscription?LoginvarpeMetadata={articleId:'',articleTitle:'',site:'Monitor',rootTitle:'Uganda',premium:true,signInPe:'/uganda/account/signin',signUpPe:'/uganda/account/signup',accountPe:'/uganda/account',subscribePe:'/uganda/subscribe',dpoCallbackPe:'/uganda/subscribe/purchase-verification',paymentCancelPe:'/uganda/subscribe/payment-cancelled',forgotPassErr:'Hmm,weareunabletofindaMonitoraccountwiththatemailaddress.Pleasecheckyourdetailsandtryain.',isPuzzlesPe:false,hasDatawall:true,hasPaywall:true,productFeatures:'|UnlimitedaccesstoallPremiumcontent|UnlimitedaccesstoMonitor|AccesstoSudokuandPuzzles|AdfreeexperienceonPremiumcontent',packeBenefitsTitle:'What39;sincluded',newsletterLoginErrMsg:'Pleaseverifyyouremailaddresstoproceed',newsletterPrimeErrMsg:'AvalidPremiumSubscriptionisrequiredtoproceed',adFreePes:'|Subscribe|Signin|Purchaseverification|Resetpassword|Paymentcancel|Emailverification|Account',peTitle:'Uganda',};window.polyfillsForOldBrowsersLoaded=false;if("Promise"inwindow&&!!window.HTMLPictureElement&&'objectFit'indocument.documentElement.style){window.polyfillsForOldBrowsersLoaded=true;}else{varf=document.getElementsByTName('script')[0];varj=document.createElement('script');j.async=true;j.src="/resource/themes/nation-2020/js/polyfills-for-old-browsers.ts--96.js";f.parentNode.insertBefore(j,f);}//Injectgoogle'sobjectintoouttypescriptcustomwindowobjetwindow.peMetadata.google=window.google;varisVideoPe=false;vartrackVideo=isVideoPe||window.hasEmbeddedVideo===true;(function(){var_sf_async_config=window._sf_async_config=(window._sf_async_config||{});/**CONFIGURATIONSTART**/_sf_async_config.uid=;_sf_async_config.domain='monitor.co.ug';_sf_async_config.flickerControl=false;_sf_async_config.useCanonical=true;_sf_async_config.useCaHome | MonitornonicalDomain=true;_sf_async_config.sections='Uganda';/**Handleusersubscribertracking*///var_cbq=window._cbq=(window._cbq||[]);//setTimeout(()=>{//varservicesWrapper=document.querySelector('[data=profile-services]');//if(servicesWrapper){//varservices=servicesWrapper.textContent;//if(services.includes('subscription')){//_cbq.push(['_acct','paid']);//}//elseif(!services.includes('subscription')&&services.includes('registration')){//_cbq.push(['_acct','lgdin']);//}else{//_cbq.push(['_acct','anon']);//}//}//},1000);/**CONFIGURATIONEND**/functionloadChartbeat(){varchartbeatScript=document.createElement('script');chartbeatScript.type='text/jascript';chartbeatScript.async=true;chartbeatScript.src='//static.chartbeat.com/js/chartbeat.js';varn=document.getElementsByTName('script')[0];n.parentNode.insertBefore(chartbeatScript,n);}functionloadChartbeatWithVideoTracking(){//YouTube'sAPIscript,requiredforChartbeat'svideoengementtracking-->varyoutubeScript=document.createElement('script');youtubeScript.type='text/jascript';youtubeScript.async=true;youtubeScript.src='///iframe_api';//ChartbeatVideoscriptvarchartbeatVideoScript=document.createElement('script');chartbeatVideoScript.type='text/jascript';chartbeatVideoScript.async=true;chartbeatVideoScript.src='//static.chartbeat.com/js/chartbeat_video.js';//Includebothscriptsvarn=document.getElementsByTName('script')[0];n.parentNode.insertBefore(youtubeScript,n);n.parentNode.insertBefore(chartbeatVideoScript,n);}if(trackVideo){/**TELLCHARTBEATTOAUTODETECTYOUTUBEVIDEOS**/var_cbv=window._cbv||(window._cbv=[]);_cbv.push(['autoDetectYouTubeIframes']);loadChartbeatWithVideoTracking();}else{loadChartbeat();}})();functionGaAccountData(webPropertyId,domainName){this.webPropertyId=webPropertyId;this.domainName=domainName;}functionGaPeviewData(disableAdFeaturesPlugin,contentId,contentType,nigationPath,peUrl,authors,pubDate,ts,queryParameter,query,userSegments){this.contentId=contentId;this.contentType=contentType;this.nigationPath=nigationPath;this.peUrl=peUrl;this.authors=authors;this.pubDate=pubDate;this.ts=ts;this.queryParameter=queryParameter;this.query=query;this.userSegments=userSegments;this.disableAdvertisingFeaturesPlugin=typeofdisableAdFeaturesPlugin!=='undefined'?disableAdFeaturesPlugin:false;}functionGaEventData(category,action,name,value){this.category=category;this.action=action;this.name=name;this.value=value;}functionsetupGa(ga,gaAccountData,gaPeviewData,trackerName){vart=_gaTrackerPrefix(trackerName);//setAccountif(trackerName&&trackerName.length>0){ga('create',gaAccountData.webPropertyId,gaAccountData.domainName,{'name':trackerName});}else{ga('create',gaAccountData.webPropertyId,gaAccountData.domainName);}ga(t.concat('set'),'anonymizeIp',true);if(!gaPeviewData.disableAdvertisingFeaturesPlugin){ga(t.concat('require'),'displayfeatures');}//setcustomvarsga(t.concat('set'),'dimension1',gaPeviewData.contentId);ga(t.concat('set'),'dimension2',gaPeviewData.contentType);ga(t.concat('set'),'dimension3',gaPeviewData.nigationPath);ga(t.concat('set'),'dimension4',gaPeviewData.userSegments);ga(t.concat('set'),'dimension5',gaPeviewData.authors);ga(t.concat('set'),'dimension6',gaPeviewData.pubDate);ga(t.concat('set'),'dimension7',gaPeviewData.ts);}functionsetGaCustomDimension(name,content,trackerName){vart=_gaTrackerPrefix(trackerName);ga(t.concat('set'),name,content);}functiongaTrackPeview(ga,gaAccountData,gaPeviewData,trackerName){vart=_gaTrackerPrefix(trackerName);varquery="";if(gaPeviewData.query&&gaPeviewData.queryParameter){query="?"+gaPeviewData.queryParameter+"="+encodeURIComponent(gaPeviewData.query);}ga(t.concat('send'),'peview',gaPeviewData.peUrl+query);}functiongaTrackEvent(ga,gaAccountData,gaPeviewData,gaEventData,trackerName){vart=_gaTrackerPrefix(trackerName);ga(t.concat('send'),'event',gaEventData.category,gaEventData.action,gaEventData.name,gaEventData.value);}function_gaTrackerPrefix(trackerName){return(trackerName&&trackerName.length>0)?trackerName.concat('.'):'';}(function(i,s,o,g,r,a,m){i['GoogleAnalyticsObject']=r;i[r]=i[r]||function(){(i[r].q=i[r].q||[]).push(arguments)},i[r].l=1*newDate();a=s.createElement(o),m=s.getElementsByTName(o)[0];a.async=1;a.src=g;m.parentNode.insertBefore(a,m)})(window,document,'script','///analytics.js','ga');vargaAccountData=newGaAccountData("UA--1","");vargaPeData=newGaPeviewData(false,"","CMChannel","","/uganda");setupGa(ga,gaAccountData,gaPeData);functionsendGaTrackPeview(){gaTrackPeview(ga,gaAccountData,gaPeData);}

Placer:Home | MonitorSignaler

En cas de violation du site, veuillez cliquer sur SignalerSignaler