Bienvenue sur le réseau d'annuaires classés! Utilisateur en ligneS'inscrire maintenant

WEBTOON - Read Comics Online

  • 2022-01-07Date de collecte
  • 2022-02-15Mise à jour
WEBTOON - Read Comics Online
  • Adresse du site Web:webtoons.com
  • IP du serveur:110.93.151.133
  • Description du site:Webtoon compte des milliers d'histoires de 23 types, dont romance, comédie, action, fantasme et horreur. Lisez des bandes dessinées, des bandes dessinées en ligne, des bandes dessinées et des bandes dessinées ou Téléchargez l'application webtoon.

nom de domaine:webtoons.comÉvaluation

sur 5000~500000

nom de domaine:webtoons.comcouler

346

nom de domaine:webtoons.comBon ou Mauvais

Entreprise prospère. Renommée et fortune Ji

site Internet:WEBTOON - Read Comics OnlinePoids

2

site Internet:WEBTOON - Read Comics OnlineIP

110.93.151.133

site Internet:WEBTOON - Read Comics Onlineteneur

WEBTOON-ReadComics,Manga&Manhwa window.__headerState__={ domain:"", phase:"release", nclkLangueCode:"en_en", langueCode:"en", cssCode:"en", cssCodePrefix:"", gaTrackingId:"UA--1", ga4TrackingId:"G-ZTE4EZ7DVX", contentLangue:"ENGLISH", contentLangueCode:'en', gakSerName:"gak.webtoons.com", gakPlatformName:"WEB_PC", serviceZone:'GLOBAL', facebookAdId:"", nclickServer:"cc.loginfra.com", lcsServer:'lcs.loginfra.com', browserType:"IE", gaPeName:"", googleAdsState:{ gadWebtoonReadEvent:"", title:"", titleNo:"", episodeNo:"", gadConversion:{ "th":[{ //GAD태국광고계정1 conversionId:"AW-9",//AW-CONVERSION_ID:GoogleAds계정에고유한전환ID conversionLabel:"yhf1CLXkr-0CEKGz_uoC"//AW-CONVERSION_LABEL:각전환액션에고유하게부여되는전환라벨 },{ //GAD태국광고계정2 conversionId:"AW-6", conversionLabel:"GzVDCNuRsO0CEKji6ekC" }] //언어가추가되면배열로넣음 } }, afPbaKey:"fe-9461-4b38-a417-7611db3b631e", } letccsrv=window.ccsrv=window.__headerState__.nclickServer; letnsc=window.nsc="webtoons.all"; letnclk_evt=window.nclk_evt=3; letlcs_SerName=window.lcs_SerName=window.__headerState__.lcsServer; letsNclkLangueCode=window.sNclkLangueCode=window.__headerState__.nclkLangueCode; skipcontent WEBTOON WEBTOONSHOP Creators101 Publish LogIn ClosetheLoginwindow Search SearchbySeriesTitleorCreator Search Delete | Close MENU ORIGINALS GENRES POPULAR CANVAS . . . . . . . . . . . . . . MON TUE WED THU FRI SAT SUN MORE MONWEBTOONS CursedPrincessClub like23.4M Comedy CursedPrincessClub LambCat MeetGwendolyn–livingproofthatprincessesdon’talwaysheitall.See,althoughshelivesinacastleandherfatheristheKing,Gwendolynisn’tlikeamovieprincess,orevenafairly-taleprincess.She’sgotabigheart,butisn’tparticularlyattractiveanddoesn’theaDisney-qualitysingingvoice.Butonenight,sheaccidentallystumblesuponthetwistedworldoftheCursedPrincessClub,andherlifewillneverbethesame.Hexedandcastout,theladiesoftheclubarejustthepeopleGwendolynneedstoshowherthatjustbecauseshedoesn’t“fitthemold”doesnotmeanshe’sanylessofaprincess. I’mtheQueeninThisLife like5.4M Fantasy I’mtheQueeninThisLife Themis/Omin TheEtruscanKingdomisstainedwithbloodwhentheking’sillegitimatesonCesareconspireswithhisfiancéeAriadnetousurpthethronefromhishalf-brotherAlfonso.DespiteAriadne’sdevotiontothenewking,herfaithisshatteredwhensheisbetrayedbyhimandeventuallymurderedbyherownsister,whowishestobequeen.Tohersurprise,Ariadnefindsherselfsentbackintimetoher17-year-oldself.Asshenigatestheperilsandopportunitiesofpalaceintrigue,Ariadnemustmakethemostofherguileandgrittoensurethathertricfuturedoesnotrepeatitself. ToTheStarsandBack like9.7M HIATUS Sliceoflife ToTheStarsandBack Peglo Introvertedandgrumpy,20-year-oldKangDaespendsthemajorityofhistimealone,andheprefersitthisway.Oneday,hegetsaveryfriendlyandbubblyneighbornamedBoSeon.Suddenly,hislifetakesaverydifferentturn. MorganaandOz Whathappenswhenastrugglingwitchmeetsanangstyvampire?Eitherloveorwar.Morganabelongstoalonglineofwitches,andOztotherivalvampireclan.Afterachanceencounter…andmaybeafewstrayspells…thesetwoneedtofindawaytoworktogether,orriskall-outwarbetweencovenandclan. like7M Fantasy MorganaandOz Miyuli Whathappenswhenastrugglingwitchmeetsanangstyvampire?Eitherloveorwar.Morganabelongstoalonglineofwitches,andOztotherivalvampireclan.Afterachanceencounter…andmaybeafewstrayspells…thesetwoneedtofindawaytoworktogether,orriskall-outwarbetweencovenandclan. SubZero like25.8M Romance SubZero Junepurrr Whatwouldyousacrificetoseyourfamily?Howfarwouldyougotoprotectyourpeople?ForClove,thelastprincessofanear-extinctDronclan,theansweristheunthinkable:MARRYyourgreatestswornenemyinanefforttobringpeacetoyourland. TenWaystoGetDumpedbyaTyrant like686,594 Fantasy TenWaystoGetDumpedbyaTyrant danmyeong/mapzzil ScarlettArmanisnoordinarylady,notjustbecauseshe’sengedtotheemperor.Newlyreincarnatedasacharacterinafantasynovel,Scarlettknowssheissupposedtodieahorribledeathatthehandsofherfiancé,CharleonKalior.Determinedtoescapeherfate,ScarlettdecidestomakeCharleonbreakofftheengement...Butwhydoeshekeepwantingtospendtimewithher?! TheLazyLordMasterstheSword like3.7M Fantasy TheLazyLordMasterstheSword Dodomoon/doip Afterwitnessingtheshockingdeathofhismother,youngAirenFarreirausessleeptoescapehispainfulreality,earninghimthenickname,“thelazylord”.Yet,inspiteofothers’jeersandwhispers,Airenhasnointentionofchanginghisways.Butwhenheawakensonedayfromadreamaboutamysteriousswordsman,hislife’strajectorytakesacompleteturn... FLOAT like746,404 Romance FLOAT CjJoaquin/KateMarchant Amidstthechaosofherparents’bitterdivorce,AlaskanteenerWerlyLyonstradesinhertextbooksandparkaforasummerofsuntansandshort-shortswithherauntinFlorida.Afishoutofwaterevenbackinthesnow,Werlyisdeterminedtobeeverythingsheisn’tbackhome:cool,fun,daresheevensaypartofagroup?There’sjustoneproblem.Shedoesn’tknowhowtoswim.EnterBlake—thesuper-tan,super-hot,super-arrogantboynextdoorwhoseemstohateherguts.Whenhediscovershersecret,Werlyispositivethatherperfectsummerisperfectlyover.ButthenBlakedoestheunthinkable.Heofferstoteachher. TowerofGod like59.2M Fantasy TowerofGod SIU Whatdoyoudesire?Moneyandwealth?Honorandpride?Authorityandpower?Revenge?Orsomethingthattranscendsthemall?Whateveryoudesire—it'shere. DownToEarth like22.4M Romance DownToEarth PookieSenpai Kadeliveshiserelifealoneandundisturbed...untilacutealiengirlcrashesintohisbackyard!Byopeninguphishome,willthisotherworldlygirlinadvertentlyopenuphisheart? TheMafiaNanny BeinganEliteNannyissimple:protectthecharge,obeytheprinciple,anddon’tgetemotionallyattached.EasiersaidthandonewhenDina’sfirstclientisadangerouslycompellingVenetianunderbosswho’sdeterminedtogetunderherskin.Whathewantsfromher,shecan’timine,butGabrielAngelinidrsherbackintotheglitteringworldoforganizedcrimeshethoughtshe’dleftbehindforever.Shemightgetanswersaboutherpastifshedigsdeepenough,butcansheprotectMikeyfromhisfather’sambitionsandkeepherheartfromgettingtangledupintheirtreacherousweb? like1.1M Romance TheMafiaNanny sh00/VioletMatter BeinganEliteNannyissimple:protectthecharge,obeytheprinciple,anddon’tgetemotionallyattached.EasiersaidthandonewhenDina’sfirstclientisadangerouslycompellingVenetianunderbosswho’sdeterminedtogetunderherskin.Whathewantsfromher,shecan’timine,butGabrielAngelinidrsherbackintotheglitteringworldoforganizedcrimeshethoughtshe’dleftbehindforever.Shemightgetanswersaboutherpastifshedigsdeepenough,butcansheprotectMikeyfromhisfather’sambitionsandkeepherheartfromgettingtangledupintheirtreacherousweb? NotYourTypicalReincarnationStory like1.8M Romance NotYourTypicalReincarnationStory LemonFrog/A-jin Notallvillainsareevil.WhenSunaChoireincarnatesasEdithRigelhof,thevillainfromherforitenovel,sheisdeterminedtochangeEdith’slifearoundandtreatseveryonewithkindness.AlthoughshemarriesthehandsomeKillianRudwick,heismadlyinlovewiththeoriginalprotonistofthebookandmistrustsEdithbecausesheisfromarivalfamily.Willhermarriesurvivethewhirlwindoffamilyfeuds,lovetriangles,andmore?WillEdithfindherhappyending? TheTyrantWantstoBeGood like3.4M Fantasy TheTyrantWantstoBeGood Ramguel/KAKON NothingwaseverhandedtoDorotheaMillanaire.Noattention,nolove,nopower.Soshedecidedtotakethemforherself…withhersword!Sheacceptsherfatewhensheisexecutedforbeingabloodthirstytyrant,onlytowakeup...asachild?!Thisishersecondchance.Shemustnotrepeathistory.Shemustbegood. OmniscientReader like27.8M Action OmniscientReader singNsong/UMI Dokjawasanereofficeworkerwhosesoleinterestwasreadinghisforitewebnovel'ThreeWaystoSurvivetheApocalypse.'Butwhenthenovelsuddenlybecomesreality,heistheonlypersonwhoknowshowtheworldwillend.Armedwiththisrealization,Dokjauseshisunderstandingtochangethecourseofthestory,andtheworld,asheknowsit. Boyfriends. like24.2M HIATUS Sliceoflife Boyfriends. refrainbow Acomicaboutgettingyourselfaboyfriend...ormultipleboyfriends!Fourcollegestudentsbeginapolyamorousrelationshipandnigatetheadventurethatistheirdatinglife! Homesick like7.9M HIATUS Thriller Homesick Ms.Freaky Raynewokeupwithnomemoriesoftheapocalypse.Samaelisjust...adelinquent,whohappenedtofindRayneatarooftop.Theybothendedupmakingadealinordertosurviveinaworldwherecannibalisticmonstersroam. Eleceed like26.8M Action Eleceed JehoSon/ZHENA Jiwooisakind-heartedyoungmanwhoharnessesthelightningquickreflexesofacattosecretlymaketheworldabetterplace–onesedlittlechildorfosterpetatatime.Kaydenisasecretentontherun,whofindshimselfstuckinthebodyofa…um…decidedlyfatoldfluffycat.Together,armedwithJiwoo’ssuperpowersandKayden’suber-smarts,they’reouttofightthoseforceswhowouldletevilrulethisworld.Thatis,iftheycanstandeachotherlongenoughtogetthejobdone. MuseonFame like2.5M Drama MuseonFame SOOJIN “I’manunknownactresswhocleanshousesasasidegig.Ironically,mynamemeansfame.”StrugglingactressMyeongstumblesuponaphotoexhibitionfilledwithphotosofheryoungerself,whenshewasfilledwithhope.Canshebecomeastarasthismysteriousphotographer’smuse? TheDronKing’sBride like2.4M Romance TheDronKing’sBride SOYMEDIA/KangheeJamae Tenyearso,ayounggirlsedthelifeofadron.Littledidtheyknowthattheywouldbebroughttogetherainbythevicissitudesoffate,whenLucina’sfamilyestateisinvadedbythefearsomeTayarnationledbyKingHakan.AfterLucina’sselfishstepmotheroffersherupasabridetoHakaninexchangefortheirlives,LucinarealizesthatsheisnowfatedtojourneytothearidkingdomofTayarandmarryitsseeminglybrutishking.Willfateleadtheunlikelypairtoruinorromance? SchoolBusGreyard Ashlynisalonerinhighschoolwithnofriends.Butwhenafatefulvisittoahauntedhousecausesherandherclassmatestoseemonstersatnight,she'llbeforcedtoforgebondstosurvive. like6.1M Thriller SchoolBusGreyard Red Ashlynisalonerinhighschoolwithnofriends.Butwhenafatefulvisittoahauntedhousecausesherandherclassmatestoseemonstersatnight,she'llbeforcedtoforgebondstosurvive. TeeneMercenary like12.6M Action TeeneMercenary YC/Rakyeon Attheeofeight,IjinYulosthisparentsinaplanecrashandbecamestrandedinaforeignland,forcedtobecomeachildmercenaryinordertostayalive.HereturnshometenyearslatertobeWEBTOON - Read Comics OnlinereunitedwithhisfamilyinKorea,wherefoodandshelterareplentyandeverythingseemspeaceful.ButIjinwillsoonlearnthatlifeasateenerisawholeotherfeatofsurvival.Withonlyoneyearofhighschoolleft,Ijinmustmasternewtacticstomaneuverhiswayaroundtheschoolhousebattleground.Canhesurviveayearofhighschool?Orrather,willtheschoolbeabletosurvivehim? HelloBaby like3.2M Romance HelloBaby Enjelicious Gwen,apprehensiveanddisheartened,spendsaone-nightaffairwithaplayfulstranger,Arthur.Afternearly2yearspass,GwenandArthurcrosspathsain-thistimefightingovertheirchild'scustody.Isitpossibletosettlethisbattleamicably,orwillGwenfindherselfdesolateonceain? JungleJuice like8M Action JungleJuice HyeongEun/JUDER SuchanJangisanextraordinarycollegestudentatthetopofthesocialfoodchain.Butunderneaththeperfectfacade,hehidesapairofinsectwingsthatsuddenlygrewwhenheusedamysteriousbugspraycalled"JungleJuice.”Suchan'slifecrumbleswhenhebareshiswingstotheworldtosesomeone'slife.Whenallhopeseemslost,Suchanstumblesuponahiddenworldofinsecthumanswhereeveryoneisacceptedforwhattheyare.Butthelawofthejunglegovernsthissecretsocietyandallmustfendforthemselvesinordertosurvive. ClinicofHorrors like7.3M Supernatural ClinicofHorrors Merryweather/PokuriMio Inastrangecity,thereisaclinicthatwilltreatthevictimsofhorrificdiseases.Foraprice. Daybreak like7.7M Sliceoflife Daybreak Moosopp Marcushasacrush,andCogiscompletelyunpreparedforthehijinksthatfollow.Hopefullyintheireffortstogrowcloser,theycanbrighteneachother'sday. TheD!ckheads like543,032 Romance TheD!ckheads GummyBunni Afterbeingbulliedatheroldschool,ElianadecidestomovetothesmalltownofOaksdaletostartfresh.ThereshebefriendsFootballCaptainandmostpopularboyatschool,Levi,aswellaslone-wolfandoutcast,Marco.She'sfinallygotthefriendsshealwayswanted,butwhatwillshedowhenshefindsouttheyhateeachother? IWillLivetheLifeofaVillainess like282,811 Romance IWillLivetheLifeofaVillainess massi/TARU Afterafatalcarcrash,YunaJeongawakensinthebodyofElenaRosaria,acharacterinthenovelshereadinherpreviouslife.Butthere'satwist—Elenaisnoordinarycharacter.She’sanotoriousvillainesswhomeetsagrimend.Now,Yunamustalterherdestinyinachaoticworldandfindherwayinthisnewlife.Cansherewriteherdestinyamidstthesurroundingchaos? unOrdinary like62.8M UP Superhero unOrdinary uru-chan NobodypaidmuchattentiontoJohn–justanormalteeneratahighschoolwherethesocialelitehappentopossessunthinkablepowersandabilities.ButJohn’sgotasecretpastthatthreatenstobringdowntheschool’swholesocialorder–andmuchmore.Fulfillinghisdestinywon’tbeeasythough,becausetherearebattles,frenemiesanddeadlyconspiraciesaroundeverycorner. EaternalNocturnal like8.4M UP Romance EaternalNocturnal instantmiso Themanofherdreamsdoesexist…toobadshecan’tfallasleep.WhenEveisvisitedonenightbyamysteriousapparition,shefindsthatherchronicinsomniaismiraculouslycured.MeanwhileDae,thedreameater,findshimselfunexpectedlyandunwillinglydrawntoEve.Thiscaneitherbeadreamcometrueortheirworstnightmare. IAmtheVillain like2.4M UP Romance IAmtheVillain Sejji Workinghardissupposedtotakeyoufar-butintotheworldofyourbestfriend'snovel?ForLucy,beingwhiskedintoalifeofballroomsandpicnicsisn'texactlywhatit'scrackeduptobe;atleast,notwheneveryonehasmistakenherforthevillainflgedfordeath.Toescapethisfate,Lucymusttransformfrommodernworkaholictohighsocietyschemerifsheevenhasachanceatreturninghome.Willshemakeit?Orwillthisworldofbeautifuloutfits,strawberrydesserts,anddashinglyhandsomegentlemensealherfate? ToTheStarsandBack like9.7M HIATUS Sliceoflife ToTheStarsandBack Peglo Introvertedandgrumpy,20-year-oldKangDaespendsthemajorityofhistimealone,andheprefersitthisway.Oneday,hegetsaveryfriendlyandbubblyneighbornamedBoSeon.Suddenly,hislifetakesaverydifferentturn. HighClassHomos like9.6M UP Comedy HighClassHomos Momozerii PrincessSapphiaofMytileneisnotintoprinces.So,whenherparentsstartputtingtheheatonhertogethitched,sheenliststhehelpofherequallygaybestfriend,PrinceAugustofPhthia.Butwillthesetworoyalsbeabletopulloffaconvincingshammarrie?Moreimportantly,willSapphiaeverlandadatewiththecastlemaids?Followthesehighclasshomosastheynigatelife,love,and(occasionally)theiractualjobs. TheGreatestEstateDeveloper like6.7M UP Fantasy TheGreatestEstateDeveloper Leehyunmin/KimHyunsoo WhencivilengineeringstudentSuhoKimfallsasleepreadingafantasynovel,hewakesupasacharacterinthebook!SuhoisnowinthebodyofLloydFrontera,alazynoblewholovestodrink,andwhosefamilyisinamountainofdebt.Usinghisengineeringknowledge,Suhodesignsinventionstoerttheterriblefuturethatliesinwaitforhim.Withthehelpofagianthamster,aknight,andtheworld’smic,canSuhodighisnewfamilyoutofdebtandbuildabetterfuture? WEBTOON - Read Comics Online BabyTyrant like1.5M UP Fantasy BabyTyrant LeeHuin/Awon GyeoulYoonisnostrangertotredy,hinglosteverything--evenherlife--becauseofhergood-for-nothingfather.Whenshereawakensafterdeath,Gyeoulfindsherselfinthebodyofanewbornbaby--sheisnowPrincessMabelofthepowerfulErmaneauEmpire!Withherdotingnewfamilyandtheempire’smightatherdisposal,Mabelhaseverythingshe’severwanted.Uponlearningthatshe’sthesubjectofaprophecywiththeworld’ssalvationatstake,Mabelquicklyrealizesthattherearepeoplewhowillstopatnothingtodestroyhernewfoundpeace. UnlovableReplacement Whenhisrelationshipwentdownthedrain,ChikoDyerstartedtodevelopaweirdrelationshipwithalocaldeliverygirl. like8.8M HIATUS Romance UnlovableReplacement Nylana Whenhisrelationshipwentdownthedrain,ChikoDyerstartedtodevelopaweirdrelationshipwithalocaldeliverygirl. MythicItemObtained like2.3M UP Fantasy MythicItemObtained Jungseonyul/Hess Inaworldwheretechnologyandmicarealmostindistinguishablefromoneanother,monstersandcreaturesofmythandlegendreignterroruponmankind.Inhumanity’sdarkestmoment,individualswithspecialgod-likepowersemergetosetheday.Theyare—theAwakened.MeetJaehyeon,afeebleAwakenedhumanRaider,whostrugglestomakeendsmeetuntilonedayaseriesofconfoundingeventsallowhimtoclaimapowerfulitemthatwillchangethecourseofhistoryforever… Operation:TrueLove like12.7M HIATUS Romance Operation:TrueLove kkokkalee/Dledumb It’sharddatingsomeonewhowon’tgiveyouthetimeofday.Su-aeShimknowsthatbetterthananyone,hingdatedherindifferentboyfriend,MinuKang,foryears.Shesometimeswishesshecouldbemorelikehercharismaticstepsister,Ra-im,whoseemstoheitall.ButlifetakesaturnfortheweirdwhenSu-aediscoversJellypop,asentientflipphone,inherlocker.Jellypophasalottosayaboutherlovelife,especiallyasSu-aedriftsfurtherawayfromMinuandfindsherselfrunningintoMinu’sfriend,Eunhyeok.AddtothemixagrowingsuspicionthatMinuandRa-immightbemorethanfriends,andSu-aemightneedamiracletonigatetheupsanddownsofhighschoolromance! SuitorArmor like11.5M Fantasy SuitorArmor Purpah Lady-in-waiting,Luciabelievesgettingthroughtheroyalweddingwillbethetoughestpartofhernewlife.ThatisuntilshefindsherselffallingheadoverheelswithModeus,anup-and-comingknighttotheking'sguard.Withhernewfoundinterest,sheisquicklyawakenedtothemysteriesofthekingdomwhenshelearnsModeusisinfactanenchantedsuitofarmorwithoutasoul.Couldtherebemoretohimthanjustshiningarmor? TheeofArrogance Afterwinningalongwar,AshaPervazisexpectingtheemperortocompensateherwithmoney.Unlikeherexpectationsthough,theemperorasksAshatochooseherownhusbandfromalistofnobles.AshachoosesDukeCarlisleHen,theemperor’seldestsonandformercrownprince.Ashaexpectshimtoobjectandpayanalimonyinstead,butthedukeactuallyreestomarryher!HeevenpromisestohelpAsharebuildPervaz.Whatdoesthedukereallywant?AndwillAshagetwhatshewantswithoutgettingembroiledinthegrowingroyalconspiracy? like920,482 Fantasy TheeofArrogance SOYMEDIA/Hansol Afterwinningalongwar,AshaPervazisexpectingtheemperortocompensateherwithmoney.Unlikeherexpectationsthough,theemperorasksAshatochooseherownhusbandfromalistofnobles.AshachoosesDukeCarlisleHen,theemperor’seldestsonandformercrownprince.Ashaexpectshimtoobjectandpayanalimonyinstead,butthedukeactuallyreestomarryher!HeevenpromisestohelpAsharebuildPervaz.Whatdoesthedukereallywant?AndwillAshagetwhatshewantswithoutgettingembroiledinthegrowingroyalconspiracy? TheGuyUpstairs like4.4M HIATUS Thriller TheGuyUpstairs HanzaArt Rozyfindsherneighbor,theguywholivesupstairsalittlebittoosuspicious. VillainwithaCrush like3.5M Romance VillainwithaCrush seyoon Dumpedafterconfessingtoherfirstcrushofthreeyears,RosaParkfallsforhersecondwhenthenation’sforiteSuperpoweredPoliceOfficer,DoryeongHan,swoopsintoseherasshe’splummetingfromatopplingbuilding.Afewyearslater,amysteriousvillaincalledBlackdogappears,butDoryeongnoticessomethingisnotquiteright.Willtheworld’sworstvillaineverwintheheartofthestrongestherointhecountry? Nevermore like4.6M Supernatural Nevermore KateFlynn/KitTrace Thereisnothingdefinitiveaboutlifeafterdeath,excepttheinvoluntaryenrollmentatthemysteriousNevermoreAcademy.NowLenoreandAnnabelLeemustbegintheircurriculumtorecoverthememoriesoftheirtricdemise.BetweentheDean'smacabredemeanorandthetell-taledangersofFinalExams,bothgirlsmustlearntorelyononeanotherandtheirnewlyacquiredghostforms,orSpectres,tonotonlygraduatefromtheacademy…buttoearnasecondchanceatlife. BailinandLiYun like378,975 Romance BailinandLiYun Jayessart Dr.LiYunisdoingresearchinthearcticwhenhemeetsastrange,injuredcreaturenamedBailin.Discoveringamythicalspeciesmightbethedreamofeveryscientist,butwillBailinbeabittoomuchtohandle?Thearctichasneverfeltsowarm. WhoStoletheEmpress? like708,545 Romance WhoStoletheEmpress? Leejihye/Muhly AsEmpress,Roselynwasbelovedbyall…exceptherhusband,whoplotswithhismistresstooustthebeautifulandsaciousconsort.Nowshefindsherselflefttodiealoneintheicymountains,witheveryoneshelovesdeadorimprisoned.Justassheisabouttoacceptthistricfate,anoldadversaryfindsherandstealsheraway…Whatcouldthisrugged,younggeneralpossiblyheinstoreforthefallenEmpressofThanatos? ILoveYoo like38M Drama ILoveYoo Quimchee Doggedbypainandmisfortunefromtheverybeginning,Shin-Aedecidesshewantsnothingtodowithpeoplenoranythingtodowithromance.Althoughcontentwithherunsocial,boring,lovelessexistence,herlifestyleischallengedaftersheruinsanunsuspectingstrangers'clothes. IThoughtMyTimeWasUp! like2.9M Romance IThoughtMyTimeWasUp! Essie/Hyeyong Feelingalittleundertheweather,LarietteBlanchevisitsDoctorZakascoffonlytofindoutthatshehasanextremelyrarecongenitaldisease,andonlythreemonthslefttolive.Thoughdevastatedatfirst,Lariettedecidestowriteupabucketlistofeverythingshewantstodobeforeshedies.However,littledidsheknowthatthedinosiswasactuallywrong!Withsomanychangesimplementedinherlifealready,whatwillLariettedomovingforward?Willshereturntoherpreviouslife,orcontinuelivingthenewone,fullofadventuresshehadneveriminedbefore? TheKissBet like14.9M HIATUS Romance TheKissBet IngridOchoa It’ssenioryearandSaraLinjustturned18.She’sgotgreatfriends,acoolDad(orsohethinks)andawholelotaheadofher.Thelastthingsheneedsistoworryabouthingherfirstkiss.Butthat’sallabouttochangebecausehergoodpalPatrickjustchallengedhertoabetthatwilleitherleadtolove,heartbreakorembarrassment…ormaybeallthree. ForMyDerelictForite Whathappensafterthestoryendswitha“happilyeverafter”?WhenHestiaentersherforitenovelasasidecharacter,shehappilyfangirlsfromthesidelines.Thinkingshe’llreturnhomewhenthestoryreachesitsend,Hestiafindsthattheonlythingawaitingheristhetricdeathofherforitecharacter.Nowmiraculouslyrestoredtothedayoftheending,Hestiadecidesthatshe’llnolongerspectatefromthesidelines–instead,she’llseherderelictforite! like3.9M Romance ForMyDerelictForite KimSeonyu/Ryuho Whathappensafterthestoryendswitha“happilyeverafter”?WhenHestiaentersherforitenovelasasidecharacter,shehappilyfangirlsfromthesidelines.Thinkingshe’llreturnhomewhenthestoryreachesitsend,Hestiafindsthattheonlythingawaitingheristhetricdeathofherforitecharacter.Nowmiraculouslyrestoredtothedayoftheending,Hestiadecidesthatshe’llnolongerspectatefromthesidelines–instead,she’llseherderelictforite! Swolemates like1.8M Comedy Swolemates LummyPix Whenthecocky,social-mediastarBraydin,andthenerdy,gamerAlexfirstmeetatthegym,theirrelationshipstartsoffonthewrongfoot.But,asthey'reforcedtoworktogethertheyfindouttheymighthemoreincommonthantheyinitiallythought.AlsotheygetbuffAF. ClinicofHorrors like7.3M Supernatural ClinicofHorrors Merryweather/PokuriMio Inastrangecity,thereisaclinicthatwilltreatthevictimsofhorrificdiseases.Foraprice. Daybreak like7.7M Sliceoflife Daybreak Moosopp Marcushasacrush,andCogiscompletelyunpreparedforthehijinksthatfollow.Hopefullyintheireffortstogrowcloser,theycanbrighteneachother'sday. DoomBreaker like5.3M Action DoomBreaker Blue-Deep Zephyristhelasthumanfightingevilinaworldabandonedbythegods.WhenheiskilledinbattlebyTartarus,thegodofdestruction,allhopeforhumanityseemslost.ButZephyr’sfateisnotsealed--thegodswhofindhisbattlesentertaininghegiftedhimasecondchanceatlife,asheissenttenyearsintothepast,backtowhenhewasasleinsteadofthemostpowerfulhumanalive.CanZephyrgethisrevengeainstTartarusandsethewomanheloves,orishedoomedtorepeatthepast? Bugtopia like436,159 Sliceoflife Bugtopia Idolomantises AspiderMomandherladybugson?Abeetlepowercouple?Abutterflypopstar?Awaspknightandabeeprincess?Inaworldsolargeforthesetinybugs,anythingispossible!Findoutwhoyou’llmeet,learnwhatsecretstheyallholdandenjoyyourstayinthislittlekingdomcalledBugtopia. WishedYouWereDead like7.8M Drama WishedYouWereDead SEOCHEONG/ARAN KingKarloiofCroisenfindshimselfatoddswithhispositioninlife.Hiswife’sfather,DukeDeluah,isanglingforthethrone,andasanoutsidertothefamily,Karloifearsforhisposition.Hisfrustrationsheaffectedhismarrie,thoughhefindshimselfquestioninghiscoldapproachtohiswife,Evonne.Hemaynolongerrecognizeher,butEvonnesedhislifelongo,andwashisfirstlove.ThisisbutoneofmanysecretsEvonnebearstheweightof,hingfallenvictimtoacursethatpreventsherfromtellinganysecrets... LoreOlympus like68.8M Romance LoreOlympus RachelSmythe Witnesswhatthegodsdo…afterdark.Thefriendshipsandthelies,thegossipandthewildparties,andofcourse,forbiddenlove.Becauseitturnsout,thegodsaren’tsodifferentfromusafterall,especiallywhenitcomestotheirproblems.Stylishandimmersive,thisisoneofmythology’sgreateststories--TheTakingofPersephone--asit’sneverbeentoldbefore. TheRemarriedEmpress like34M WEBTOON - Read Comics Online Fantasy TheRemarriedEmpress Alphatart/Sumpul NierEllieTroviwasanempressperfectineveryway--intelligent,coureous,andsociallyadept.Shewaskindtohersubjectsanddevotedtoherhusband.NierwasperfectlycontenttolivetherestofherdaysasthewiseempressoftheEasternEmpire.Thatis,untilherhusbandbroughthomeamistressanddemandedadivorce.“Iacceptthisdivorce…AndIrequestanapprovalofmyremarrie.”Inashockingtwist,Nierremarriesanotheremperorandretainshertitleandchildhooddreamasempress.Butjusthowdideverythingunfold? MyIn-LawsareObsessedwithMe like9.2M Fantasy MyIn-LawsareObsessedwithMe seungu/HanYoonseol PereshatiJahardtisacount'sdaughterwhogotremarriedafterhermother’spassing.Whenherfatherdied,heleftherallhisfortune.Then,Pereshati'sgreedystepmotherandstepsisterconspirewithPereshati'slovertokillher.However,undermysteriouscircumstances,Pereshatiisbroughtbacktolifeandtrelsbackintimebeforehermurder.Tobuysometimebeforegettingherrevenge,Pereshativisitsthehandsomeyetnotoriousgrandduke,TherdeoLapileon,tomarryhim.Duringhervisit,sheuncoversahorrifyingsecretofhisfamily.HowwillPereshatidealwithit?Willshebeabletotakeherrevenge? CastleSwimmer like25.5M Fantasy CastleSwimmer WendyLianMartin Whathappenswhenyourentirelifeisruledbyaprophecy–yourfutureforetoldbypeopleyou’venevermet,whodiedlongbeforeyouwereborn.Suchisthestoryoftwoyoungseacreatures.Onebelievedtobeaguidinglightforhispeople,aBeaconwhowillleadthemtoabright,prosperousfuture.Theotherisateeneprinceforwho’sdestinyistoKILLtheBeaconsothatHISownpeoplemightthrive.Whenbothrejectthecoursesetforthem,itleadstoaraucousadventureasbigandunpredictableastheoceanitself–andaromancethatnobodycouldhepredicted. HighClassHomos like9.6M UP Comedy HighClassHomos Momozerii PrincessSapphiaofMytileneisnotintoprinces.So,whenherparentsstartputtingtheheatonhertogethitched,sheenliststhehelpofherequallygaybestfriend,PrinceAugustofPhthia.Butwillthesetworoyalsbeabletopulloffaconvincingshammarrie?Moreimportantly,willSapphiaeverlandadatewiththecastlemaids?Followthesehighclasshomosastheynigatelife,love,and(occasionally)theiractualjobs. ObsidianBride Forallherlife,poorLuerihasbeenhangingbyathread,andthesituationdoesn'tgetanybetterwhensheisforcedintoanunwelcomemarrie.Butbymiracleordesign,amicalinvitationpresentsherwithawayofescapingherlovelesslife--byjoiningtheempire’sJewelBox.There,amongthebrilliantgemstones,shefindshelpintheunlikeliestofplaces,friendsfromtheunlikeliestofcrowds,andperhaps,somethingshe’sbeendesperatelyyearningforuntilnow--truelove. like348,320 Romance ObsidianBride V0RA/Chungpurm Forallherlife,poorLuerihasbeenhangingbyathread,andthesituationdoesn'tgetanybetterwhensheisforcedintoanunwelcomemarrie.Butbymiracleordesign,amicalinvitationpresentsherwithawayofescapingherlovelesslife--byjoiningtheempire’sJewelBox.There,amongthebrilliantgemstones,shefindshelpintheunlikeliestofplaces,friendsfromtheunlikeliestofcrowds,andperhaps,somethingshe’sbeendesperatelyyearningforuntilnow--truelove. TheAcademy'sGeniusSwordsman like472,154 Fantasy TheAcademy'sGeniusSwordsman SeoGwando/C.H Followingamomentousbattleainstgiantsforthefateoftheworld,Ronanemergesvictoriousasthelastmanstandingoftheimperialarmy.Ashelamentsthishollowvictorywithhisdyingcommander,GrandMarshalAdeshan,theyquicklylearnthatthewarisfarfromoverandanoverwhelmingforceofgiantsdescendsfromtheheens.Fearingtheworst,yetseeinghopeinthecoureousRonan,Adeshanusesherlasttimesliptosendhimbacktothepast,sothathecanenrollintheprestigiousPhileonAcademyandbecomethestrongestswordsmantheempirehaseverseen! FromaKnighttoaLady like6.7M Fantasy FromaKnighttoaLady Ink./HyerimSung EstellemeetsheruntimelydeathasavaliantknightoftheKingdomofErsha.ButdeathisnottheendforEstelle--threeyearsafterherdemise,shefindsherselfreincarnatedinthebodyofLucifelaAydin,thespoiledandcold-hearteddaughterofacountintheEmpireofJansgar.Toherdismay,shefindsthathercountryfelltoJansgaryearso,andthatsheisnowbetrothedtoZedekiahHeint,thesonofadukeandheradversaryinherpreviouslife.CanEstellediscoverthetruthbehindherdeathwhileattemptingtonigatehernewlifeasLucifela? BoundlessAscension like1M Action BoundlessAscension 2love(REDICESTUDIO)/SHYATAN(REDICESTUDIO) Seong-yunHanwasjustaboywhenhisparentswerekilledbymonstersunleashedduringamysteriouscalamitycalledthe“DungeonBreak.”Sevenyearslater,Seong-yunisdevastatedtofindthathisgrindingeffortstobecomeaHunter,fiercewarriorswhoseekoutanddestroymonsters,areentirelyinvain,ashisfightingattributeshenotincreasedatall.Seong-yun’sworldflipsonadimewhenheacceptsaninvitationtojointheTowerofTrials,anotherworldlyrealmwherechallengersmustovercometrialsthatpitthemainstmonstersandhumansalike. NewtoWEBTOON IGiveYouMyAll like43,572 NEW Romance IGiveYouMyAll seokyeong/mangnanyong SehuiYun,apromisingdesigner,livesasnothingmorethanapuppetforherfamilyandisundertheconstantwatchofherabusivestepmother.Oneday,shemeetsaseeminglyperfectman,TaehyeongHan,whooffersheranamazingjobtofreeherfromhershackles.However,itseemshemaywantmorethanjustastandardworkrelationship. God'sGambit like39,936 NEW Action God'sGambit 2HD/Bsamong Dogodsplaydicewiththefateofentirecities?YulChoi’scityissuddenlytransportedtobecomeapieceinaboardgameofthegods.JustwhenYulthinkshecanworktogetherwithpeopletoovercomethemonstersandchallenges,herealizeshemustbecomethecity’sgreatestvillaintosethecity.CanYulrisetothedemandingtaskofbecomingthegreatestandmostvillainousherohiscityhaseverseen? LoveorAttraction like31,025 NEW Romance LoveorAttraction Yuu/Myeong Isittrulylovewithoutphysicalattraction?Byeoldumpedherboyfriendafteradisappointingnightinthebedroom,whereasGyeolgotdumpedforbeing"toomuch."Thesetwo,withclashingideasaboutlove,aresettogethertoworkonthestudentcouncil.Willtheirmisunderstandingsonlydeepentheriftbetweenthem,orwilltheycometolearnfromeachother? TraceKeeper Whenanaccidentkillsoverfortypeopleinasmallminingtown,twohighschoolstudentsventureintoanunderworldfilledwithinnumerablewondersinordertoexposeadeepconspiracyattheheartofacreepingcorruption;anexplorationonlivingwithgrief,hand-in-handwithdeath. like16,847 NEW Supernatural TraceKeeper KAYRAA Whenanaccidentkillsoverfortypeopleinasmallminingtown,twohighschoolstudentsventureintoanunderworldfilledwithinnumerablewondersinordertoexposeadeepconspiracyattheheartofacreepingcorruption;anexplorationonlivingwithgrief,hand-in-handwithdeath. Spore like34,839 NEW Thriller Spore Leekang Oneday,anunidentifiedflyingobjectappearsintheskyalongwithunknowninsect-likemonsters.Anormalhighschoolstudent,SeunghoYun,istryingtosurviveaswellasfindhisfamily.Alongtheway,heisaidedbyamessethattellshimthefuturethatonlyappearsinhishead.Ashemovesonwiththatslightadvante,hefindsoutthatthereareotherswhoaregettingthesamemesseashim.Willhebeabletofindhisfamily?Andwherearethemessesinhisheadcomingfrom? CityVamps like140,354 NEWEND Romance CityVamps seashell_arts Adam,ahalf-vampirelivingwithhisfatherinthecity,eerlyanticipatesgainingfullvampirepowersatacertaine.However,uponturning17,hegrappleswiththechallengesofcontrollinghisabilitiesandnigatingcomplexemotions,suchaslove… TheScarletTelkemist like20,627 NEW Fantasy TheScarletTelkemist Chamileon Hellbentonengingthosehe’slost,ValerianvowstohuntdowntheScarletTelkemist,leaderofillicitblood-micuserscalledvourdaks.ButwhenAlesya,adeadgirlfromhispast,turnsupaliveandamnesiac,herealizesthevourdaks’secretsrundeeperthanhe'dimined.CanAlesyabethekeytohelpingValeriancapturetheScarletTelkemistonceandforall,orwillshebringhisundoing? BackFromBlack Zak,thegreatestassassintoeverlive,getsbetrayedandkilled,onlytowakeuptwocenturieslaterinabioengineeredbody.Hingbeenunabletosehiswifeandkeephispromisetoher,Zakuseshisnewbody,andtheNano-technologyhiddenwithin,tonigatethroughanewfuturisticeofassassinsandseekouttheonesresponsibleforhistredy. like12,736 NEW Action BackFromBlack GOXTOON/M3 Zak,thegreatestassassintoeverlive,getsbetrayedandkilled,onlytowakeuptwocenturieslaterinabioengineeredbody.Hingbeenunabletosehiswifeandkeephispromisetoher,Zakuseshisnewbody,andtheNano-technologyhiddenwithin,tonigatethroughanewfuturisticeofassassinsandseekouttheonesresponsibleforhistredy. prev next GENRES New&Trending > 1 Action BackFromBlack GOXTOON/M3 2 Fantasy TheScarletTelkemist Chamileon 3 Drama TheSeductiveWife YoonSoda/RedpeachStudio 4 Action TheStellarSwordmaster HongDaeUi/juno 5 Action Steel-EatingPlayer Director9/JJJ Noailableseriesyet.Pleasecheckbacklater. ORIGINALSbyGenre > ACTION (selected) ALL ACTION (selected) ROMANCE FANTASY DRAMA COMEDY THRILLER SLICEOFLIFE SUPERNATURAL SCI-FI HORROR Others 1 Action OmniscientReader singNsong/UMI 2 Action TeeneMercenary YC/Rakyeon 3 Action Eleceed JehoSon/ZHENA 4 Action DoomBreaker Blue-Deep 5 Action JungleJuice HyeongEun/JUDER Noailableseriesyet.Pleasecheckbacklater. WEBTOONCANVAS Heastorytotell?ShareitonWEBTOONCANVAS. Findeverythingyouneedtogetitpublished. Findoutmore CardCastle Noo! RocketFist noahkosiba SpaceBestie:Invasion MelonDeke TheStinkyBossCat 巧西Chelsealy shaa shaaill José&Miguel ShoiZino Jay39;nMila Blujayooo Cat llLoneWolfll ThisIsNotTheEnd; Serapheir; TheDreamEater narriose WEBTOON DownloadWEBTOONnow! GETITonGooglePlay DownloadontheAppStore facebook instram twitter youtube About | Feedback | Help | Terms | Privacy | PersonalData | Advertise | DoNotSellorShareMyPersonalInformation | Contact | English 中文(繁體) ภาษาไทย Indonesia Español Français Deutsch ⓒNERWEBTOONLtd. WEBTOON window.defaultErrorMesse={ 'alert.error.no_internet_connection':'NoInternetConnection.\nPleasecheckthenetworkconnection.', 'alert.error.invalid_input':'Invalidinputvalue.', 'alert.error.unknown':'Unknownerrorhasoccurred.Pleasetryaininamoment.'};window.__commonScriptState__={ contentLangue:'ENGLISH', contentLangueCode:"en", browserType:"IE", countryCode:"CN", isNotNoticePe:true, domain:'', recentBarParam:{ imgDomain:'webtoon-phinf.pstatic.net', langue:'en', title:'Recentlyviewed', domain:'', contentLangue:'en' }, noticeParam:{ domain:"", contentLangueCode:"en", nclkLangueCode:"en_en", messes:{ "menu.notice":"Notice" } }, loginOptions:{ isAuthorPublishLogin:false, authorPublishDescLinkUrl:"/en/creators101/webtoon-canvas", ailableSnsList:["GOOGLE","APPLE","FACEBOOK","LINE","TWITTER"], nclkLangueCode:"en_en", messes:{ "login.default.component.default.title":'Loginnowandenjoyfreecomics', "login.default.component.default.desc":'Startreadingthousandsoffreecomicswithotherfansandcreators!', "login.default.component.email.button":'ContinuewithEmail', "login.default.component.sns.button.GOOGLE":'ContinuewithGoogle', "login.default.component.sns.button.APPLE":'ContinuewithApple', "login.default.component.sns.button.FACEBOOK":'ContinuewithFacebook', "login.default.component.sns.button.LINE":'ContinuewithLINE', "login.default.component.sns.button.TWITTER":'ContinuewithX', "alert.error.invalid_input":'Invalidinputvalue.', "alert.error.unknown":'Unknownerrorhasoccurred.Pleasetryaininamoment.', }, emailLoginOptions:{ captchaKey:"", emailLoginUrl:"/member/login/doLoginById", messes:{ "alert.error.unknown":'Unknownerrorhasoccurred.Pleasetryaininamoment.', "button.login":'LogIn', "menu.back":'Back', "login.email.component.title":'EmailLogin', "login.email.component.email_input.label":'EMAILADDRESS', "login.email.component.email_input.placeholder":'EnterEmailAddress', "login.email.component.email_input.warn.please_check":'Pleasecheckyouremailaddress ain.', "login.email.component.password_input.label":'PASSWORD', "login.email.component.password_input.placeholder":'EnterPassword', "login.email.component.password_input.button.show_password":'showpassword', "login.email.component.password_input.warn.please_check":'Pleasecheckyourpasswordain.', "login.email.component.password_input.warn.incorrect_multiple_times":'Youheenteredanincorrectpasswordover5times.', "login.email.component.password_input.warn.max_length":'Passwordscanbeupto16characters.', "login.email.component.captcha_input.placeholder":'Enterwhatappearsabove', "login.email.component.captcha_input.button.reload":'captchareload', "login.email.component.messe.influent.sign_up":'Don\'theanaccount?', "messe.login.forget_password":'ForgotPassword?', "button.signup":'SignUp', }, }, }, gdprCookieBannerMesses:{ 'gdpr.cookie_reement_banner.desc':'WEBTOONusescookiesnecessaryforauthenticationandsecuritypurposes.Wewouldalsoliketouseoptionalcookiestoprovidepersonalizedcontentandtoimproveourservicesbasedonhowyouusesuchservices.Youcanacceptorrefusealloptionalcookiesbyclickingontherelevantbuttonsbeloworyoucanmanetheuseofoptionalcookiesbyclickingonthe\'CookieSettings\'button.Formoreinformationoncookies,pleasereadour\u003Cahref=\":\/\/\/en\/terms\/cookiePolicy\"target=\"_blank\"\u003ECookiePolicy\u003C\/a\u003E.', 'gdpr.cookie_reement_banner.ree':'Iree.', 'gdpr.cookie_reement_banner.cookie_setting':'CookieSettings' }, ccpaCookieBannerMesses:{ 'ccpa.cookie_reement_banner.desc':'IreethatWEBTOONmayprocessmypersonalinformationinaccordancewiththeWEBTOON\u003Cahref=\":\/\/\/en\/terms\/privacyPolicy\"target=\"_blank\"\u003EPrivacyPolicy\u003C\/a\u003EandthatmypersonalinformationmaybedisclosedtotrustedthirdpartiesofWEBTOONforadvertisingandmarketingpurposes.IconfirmthatIamauthorizedtoprovidethisconsent.Theuseofdatacanbemanedinthe\u003Cahref=\":\/\/\/en\/cookieSetting\"\u003ECookieSettings\u003C\/a\u003Eand\/oratthelinkbelow.\u003Cbr\u003E', 'ccpa.cookie_reement_banner.desc.do_not_sell':'DoNotSellorShareMyPersonalInformation', 'ccpa.cookie_reement_banner.title':'ConsenttoThirdPartyAdvertisingandMarketing', 'ccpa.cookie_reement_banner.confirm':'Confirm', }, gdprChildProtectionPopupMesses:{ 'gdpr.child_protection_popup.challenge.header':'CANVASisunailabletochildrenundertheeof16residinginGermany.', 'gdpr.child_protection_popup.challenge.desc':'InordertocomplywiththeGermanYouthProtectionLaw,theuseofCANVAShasbeenrestricted.Pleaserefertoour\u003Cahref=\":\/\/help2.line.me\/LINE_WEBTOON\/pc?contentId=&lang=en\"target=\"_blank\"\u003EHelp\u003C\/a\u003Esectionformoreinformation.', 'button.ok':'OK' }, policyreePopupParam:{ domain:"", contentLangueCode:"en", nclkLangueCode:"en_en", messes:{ 'policy.popup.title':'Greetingsfrom\u003Cbr\u003ENERWEBTOONLtd.', 'policy.popup.text':'Tofullyenjoyourservice,youmustreetothenewandupdatedTermsofUseandPrivacyPolicy.', 'policy.popup.desc':'Ireetothe{tou}and{pp}ofWEBTOON.', 'policy.popup.desc.tou':'TermsofUse', 'policy.popup.desc.pp':'PrivacyPolicy', 'policy.popup.caution':'Checkabovetoproceed.', 'policy.popup.submit':'Submit', 'policy.popup.cancel':'Cancel', 'policy.popup.cancel.continue':'Continuewithoutloggingin', 'policy.popup.text_for_gdpr':'Tofullyenjoyourservice,youmustreetothenewandupdatedTermsofUse.', 'policy.popup.desc_for_gdpr':'Ireetothe{tou}ofWEBTOON.', 'policy.popup.desc_for_gdpr_privacy':'Pleaseseeournewandupdated{pp}.', } }} window.__gnbState__={ locale:'en' ,gnbLayerId:'#header' ,messe:{ logoutMesse:'Areyousureyouwanttologout?' ,systemErrorMesse:'Unknownerrorhasoccurred.Pleasetryaininamoment.' } ,searchParam:{ locale:'en', messe:{ 'confirm.search.delete_history':'Areyousureyouwanttodeleteyourrecentsearchhistory?', 'messe.search.clear':'ClearRecentSearches', 'messe.search.autocomplete.webtoon':'WEBTOON', 'messe.search.autocomplete.artist':'Creator', 'messe.search.autocomplete.view_all':'ViewAll', 'messe.search.autocomplete.close':'Close' }, imgDomain:'webtoon-phinf.pstatic.net', templateParam:{ nclkLangueCode:"en_en", imeDomain:"webtoon-phinf.pstatic.net", messes:{ 'confirm.search.delete_history':'Areyousureyouwanttodeleteyourrecentsearchhistory?', 'messe.search.clear':'ClearRecentSearches', 'messe.search.autocomplete.webtoon':'WEBTOON', 'messe.search.autocomplete.artist':'Creator', 'messe.search.autocomplete.view_all':'ViewAll', 'messe.search.autocomplete.close':'Close' } } }, myLayerParam:{ domain:"", nclkLangueCode:"en_en", contentLangueCode:"en", communityProfileUrl:"", isailableCoinShop:false, supportsAuthorCommunity:true, messes:{ 'menu.forite':'Subscribed', 'menu.dashboard':'Dashboard', 'menu.mycomment':'Comments', 'menu.creator':'Creators', 'menu.mypost':'MyProfilePe', 'menu.account':'Account', 'menu.ads':'AdSharing', 'menu.coin.shop':'CoinShop', 'button.logout':'LogOut' } }, langueCode:'en', childProtectorParams:{ messes:{ "main":"Thisfeatureisunailable.Pleasereferto\u003Cbr\u003Ethe{childpp}formoreinformation.", "childpp":"Children’sPrivacyPolicy", "ok":"Close", }, childppLink:"/en/terms/childrensPrivacyPolicy" }, signUpLayerParam:{ domain:"", contentLangueCode:"en", nclkLangueCode:"en_en", messes:{ "messe.signup.desc":"IreetoWEBTOON\'s\u003Cahref=\":\/\/\/en\/terms?noLogin=true\"target=\"_blank\"className=\"N=a:log.termsofuse,g:en_en\"\u003E\n\t\tTermsofUse\n\t\u003C\/a\u003Eand\u003Cahref=\":\/\/\/en\/terms\/privacyPolicy?noLogin=true\"target=\"_blank\"className=\"N=a:log.privacy,g:en_en\"\u003E\n\t\tPrivacyPolicy\n\t\u003C\/a\u003E.", 'messe.signup.need_ree':'Clickthecheckbuttonbeforesubmitting.', 'button.sign_up':'Submit' } }, }; window.__rankingState__={ contentLangueCode:"en", rankingCount:5, rankingTemplateParam:{ domain:"", contentLangueCode:"en", nclkLangueCode:"en_en", imgQuality:"q90", imeDomain:"webtoon-phinf.pstatic.net" }, genreNameMap:{ 'ACTION':'Action', 'COMEDY':'Comedy', 'DRAMA':'Drama', 'FANTASY':'Fantasy', 'HEARTWARMING':'Heartwarming', 'HISTORICAL':'Historical', 'HORROR':'Horror', 'MYSTERY':'Mystery', 'ROMANCE':'Romance', 'SF':'Sci-fi', 'SLICE_OF_LIFE':'Sliceoflife', 'SPORTS':'Sports', 'SUPERNATURAL':'Supernatural', 'SUPER_HERO':'Superhero', 'THRILLER':'Thriller', 'TIPTOON':'Informative' }, challengeRankingGenreNameMap:{ }, rankingComponentInfoList:[ { "rankingComponentType":"WEBTOON_NEW_TITLE_RANKING", "queryParamKey":"", "titleListMaxSize":"5" }, { "rankingComponentType":"WEBTOON_GENRE_RANKING", "queryParamKey":"rankingGenre", "titleListMaxSize":"5" }, ], isPopularTabComponent:true, } window.__emailVerificationResultState__={ contentLangueCode:"en", messes:{ fail:{ "unknown":"Unknownerrorhasoccurred.Pleasetryaininamoment.", "expire":"Theverificationlinkhasexpired.Pleasetryaintoheanewverificationemailsent.", }, changeEmail:{ "content":"Thankyou.\u003Cbr\u003EYouremailhasbeenverified.", }, join:{ "title":"WelcometoWEBTOON!", "content":"Youremailhasbeenverified.You\'rereadytostartenjoyinghundredsoffreecomics!", "button":"Getstarted!", }, "okButton":"OK" }, }varghtGenreList={ ACTION:{ sName:'Action', sIntoduction:'Click,Scroll,andAction.', sSeoCode:'action', nCount:0 }, COMEDY:{ sName:'Comedy', sIntoduction:'Goodlaughterisallweneed.', sSeoCode:'comedy', nCount:0 }, DRAMA:{ sName:'Drama', sIntoduction:'Yourdailystripofdrama.', sSeoCode:'drama', nCount:0 }, FANTASY:{ sName:'Fantasy', sIntoduction:'Immerse,Imine,andInspire.', sSeoCode:'fantasy', nCount:0 }, HEARTWARMING:{ sName:'Heartwarming', sIntoduction:'Warmblankiesforyoursoul.', sSeoCode:'heartwarming', nCount:0 }, HISTORICAL:{ sName:'Historical', sIntoduction:'Openthedoortotrelthroughtimeandspace.', sSeoCode:'historical', nCount:0 }, HORROR:{ sName:'Horror', sIntoduction:'Doyoulovebeingscared?', sSeoCode:'horror', nCount:0 }, MYSTERY:{ sName:'Mystery', sIntoduction:'Uncoverthecrime!', sSeoCode:'mystery', nCount:0 }, ROMANCE:{ sName:'Romance', sIntoduction:'Beauty,romance,love:Thingswelivefor.', sSeoCode:'romance', nCount:0 }, SF:{ sName:'Sci-fi', sIntoduction:'Exploretheworldofscienceandinnovations.', sSeoCode:'sf', nCount:0 }, SLICE_OF_LIFE:{ sName:'Sliceoflife', sIntoduction:'Relateandsmile.', sSeoCode:'slice-of-life', nCount:0 }, SPORTS:{ sName:'Sports', sIntoduction:'Feelthepumped-upenergy.', sSeoCode:'sports', nCount:0 }, SUPERNATURAL:{ sName:'Supernatural', sIntoduction:'Witches,werewolves,andcryptids.Ohmy!', sSeoCode:'supernatural', nCount:0 }, SUPER_HERO:{ sName:'Superhero', sIntoduction:'Comesetheworldwithme.', sSeoCode:'super-hero', nCount:0 }, THRILLER:{ sName:'Thriller', sIntoduction:'Chill,Shiver,andShudder', sSeoCode:'thriller', nCount:0 }, TIPTOON:{ sName:'Informative', sIntoduction:'Tipsthatmaybringyouabetterlife!', sSeoCode:'tiptoon', nCount:0 } }window.__homeState__={ adParam:{ adOptions:{"slotId":"//PC_Main_Leaderboard_970x90_ime","adDivId":"div-gpt-ad-5","adPlatform":"GLAD","bidder":{"pubmatic":{"publisherId":"","adSlot":"Main_Mid_Desktop"},"triplelift":{"inventoryCode":"Webtoon_ROS_HDX_Prebid","floor":"0.15"},"rubicon":{"accountId":"","siteId":"","zoneId":""},"openx":{"unit":"7","delDomain":"linewebtoon-d.openx.net"}}}, targetings:{ langue:"en" ,productName:"linewebtoon" ,contentId:"common" }, sdkUrl:"ssl.pstatic.net/tveta/libs/glad/prod/gfp-core.js" }, homeParam:{ nclkLangueCode:"en_en", likeitSmallMesse:"Like", langueCode:"en", genreList:ghtGenreList, foriteGenreTemplateParam:{ domain:"", contentLangueCode:"en", nclkLangueCode:"en_en", imeDomain:"webtoon-phinf.pstatic.net" } }, eventWinnerPopupParam:{ templateParam:{ messes:{ 'messe.event_winner_popup.name':'Name', 'messe.event_winner_popup.email':'EmailAddress', 'messe.event_winner_popup.phone_number':'Phone', 'messe.event_winner_popup.address':'Address', 'messe.event_winner_popup.name.placeholder':'Entername', 'messe.event_winner_popup.email.placeholder':'aaa@bbb.com', 'messe.event_winner_popup.phone_number.placeholder':'Enterphonenumber', 'messe.event_winner_popup.address.placeholder':'Enteraddress', 'messe.event_winner_popup.name.warning':'Pleaseenteryourname.', 'messe.event_winner_popup.email.warning':'Pleaseenteryouremailaddress.', 'messe.event_winner_popup.phone_number.warning':'Pleaseenteryourphonenumber.', 'messe.event_winner_popup.address.warning':'Pleaseenteryouraddress.', 'messe.event_winner_popup.check_terms.1':'IreetoWEBTOON\'s', 'messe.event_winner_popup.check_terms.2':'.', 'messe.event_winner_popup.check_fees':'IreethatIamresponsibleforalltaxes,fees,andsurchargesonprizes.', 'messe.event_winner_popup.check_fees.warning':'Pleasecheckabovetoproceed.', 'messe.event_winner_popup.check_terms.privacy_policy':'PrivacyPolicy', 'messe.event_winner_popup.submit':'Submit', 'messe.event_winner_popup.refuse':'Irefusetoprovidemyinformation.', 'messe.event_winner_popup.refuse.confirm':'Don\'twishtoprovideyourinformationtoreceivethegiveaway?Ifyourefusenow,thisinformationpewillnotbeshownain.', }, domain:"", contentLangueCode:"en" } }}

Placer:WEBTOON - Read Comics OnlineSignaler

En cas de violation du site, veuillez cliquer sur SignalerSignaler